PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00054.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 317aa    MW: 35905.1 Da    PI: 8.2285
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00054.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.83e-55161431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+t
  Rsa1.0_00054.1_g00014.1  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTT 100
                              79*************************999.88***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke++++ ++elvg+kktLvfy+grap+gekt+Wvmheyrl
  Rsa1.0_00054.1_g00014.1 101 GKDKEIFNStTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143
                              *******9878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-6312165IPR003441NAC domain
PROSITE profilePS5100561.43916165IPR003441NAC domain
PfamPF023658.4E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEQGDHQQQK QEEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPEKAKMGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEIFNST TSELVGMKKT  120
LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKQDEWVVC RVFKKTEATK KYISNSSSST  180
SHHHQNHTRA SILSTNNNNP NYSSDLLQLP PHLQPHTSLN INQTIMANAV HLAELSRVFR  240
GSTSSTMDSA HQQLMSYNQM PVSGLNLNLG GALVQPPPPT VSLEDVVAVS ASFNGENGFG  300
NVEMSQCMDL DGYWPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-581517116171NAC domain-containing protein 19
4dul_A3e-581517116171NAC domain-containing protein 19
1ut7_B3e-581517116171NO APICAL MERISTEM PROTEIN
1ut7_A3e-581517116171NO APICAL MERISTEM PROTEIN
1ut4_B3e-581517116171NO APICAL MERISTEM PROTEIN
1ut4_A3e-581517116171NO APICAL MERISTEM PROTEIN
3swp_D3e-581517119174NAC domain-containing protein 19
3swp_C3e-581517119174NAC domain-containing protein 19
3swp_B3e-581517119174NAC domain-containing protein 19
3swp_A3e-581517119174NAC domain-containing protein 19
3swm_D3e-581517119174NAC domain-containing protein 19
3swm_C3e-581517119174NAC domain-containing protein 19
3swm_B3e-581517119174NAC domain-containing protein 19
3swm_A3e-581517119174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064031e-166AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence.
GenBankCP0026851e-166CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013747034.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotO040174e-80NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLA0A078G4J60.0A0A078G4J6_BRANA; BnaC04g36420D protein
STRINGBra032095.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.20.0NAC domain containing protein 38